SKU: 99976638778

Axl His Tag Protein, Mouse

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Axl His Tag Protein, MouseProduct Specification Species Mouse Synonyms Axl, UFO, Tyro7, JTK11, ARK Accession Q00993 Amino Acid Sequence His20 Pro443, with C terminal 10*His

Product Specification


Species Mouse
Synonyms Axl, UFO, Tyro7, JTK11, ARK
Accession Q00993
Amino Acid Sequence His20-Pro443, with C-terminal 10*His HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 60-78kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Weinger J G. et al. (2011) Loss of the receptor tyrosine kinase Axl leads to enhanced inflammation in the CNS and delayed removal of myelin debris during Experimental Autoimmune Encephalomyelitis. J Neuroinflammation. 8: 49.

2、Linger R M. et al. (2010) Taking aim at Mer and Axl receptor tyrosine kinases as novel therapeutic targets in solid tumors. Expert Opin Ther Targets. 14(10): 1073-1090.

3、Cavet M E. et al. (2010) Gas6-Axl pathway: the role of redox-dependent association of Axl with nonmuscle myosin IIB. Hypertension. 56(1): 105-111.

4、Rankin E B. et al. (2010) AXL is an essential factor and therapeutic target for metastatic ovarian cancer. Cancer Res. 70(19): 7570-7579.

Background

AXL Receptor Tyrosine Kinase is also known as Tyrosine-protein kinase receptor UFO, which belongs to the protein kinase superfamily, Tyr protein kinase family and AXL/UFO subfamily. Mature human Axl consists of a 426 aa extracellular domain (ECD) that contains two Ig-like domains and two fibronectin type III domains, a 21 aa transmembrane segment, and a 422 aa cytoplasmic domain that includes the tyrosine kinase domain. In the nervous system, Axl and its ligand Growth-arrest-specific protein 6 (Gas6) are expressed on multiple cell types. Axl functions in dampening the immune response, regulating cytokine secretion, clearing apoptotic cells and debris, and maintaining cell survival. Axl is upregulated in various disease states, such as in the cuprizone toxicity-induced model of demyelination and in multiple sclerosis (MS) lesions, suggesting that it plays a role in disease pathogenesis. The receptor tyrosine kinase (RTK) AXL has been associated with poor prognosis in numerous malignancies and the emergence of therapy resistance. Upon binding to its ligand GAS6, AXL regulates cell signaling cascades and cellular communication between various components of the tumor microenvironment, including cancer cells, endothelial cells, and immune cells. Converging evidence points to AXL as an attractive molecular target to overcome therapy resistance and immunosuppression, supported by the potential of AXL inhibitors to improve ICI efficacy. Axl contributes to cell survival, migration, invasion, metastasis and chemosensitivity justify further investigation of Axl as novel therapeutic targets in cancer. The soluble AXL receptor as a therapeutic candidate agent for treatment of metastatic ovarian cancer.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99976638778

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 2232 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Morgan Jones
Carnegie, US
★★★★★ 5
Foams nicely and doesn’t break you out
Love this face wash feels like a spa facial, lathers nicely, really helped clear up my acne
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
R
Verified Purchase
Rohit K
Battle Creek, US
★★★★★ 5
Best Skin cleanser
Best ever. Deep cleans pore and I can see makeup melting off the face once you wash with this. Post results: Super clean soft skin, my face shines. Been using only for 2 weeks now, so cannot comment on Pore size reduction. Extra sensitive eczema skin approved.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
G
Verified Purchase
GramE2Caia
Port Orchard, US
★★★★★ 5
Nice products with positive results
I bought Anua toner, trio, and moisturizer. I am in love with these products. They clean your skin really well without leaving residue. They moisturize without leaving your skin oily, and after less than a week of use, I'm already seeing improvement in my skin texture. It really is a good value for the price and how much you use each time. All of this with no irritation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
M
Verified Purchase
Mediahound 🎧
Carnegie, US
★★★★★ 5
Great for sensitive skin!
Most azelaic acid serum make my skin feel prickly or even a slight burning sensation so I was glad to find this, which has a lower percentage of azelaic acid but also combines CICA. This product does not irritate my sensitive skin and I still get some calming benefits. I use it in place of a toner after washing my face and before other products. It does seem to help calm my rosacea. Note that this is more soothing than moisturizing so you may still want some sort of barrier cream to use over it at night. It works great under my sunscreen during the day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
A
Verified Purchase
Amazon Customer
Waukegan, US
★★★★★ 5
Good
Deja la piel hidratada desde su primer uso.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products