SKU: 47176477191

Fc epsilon RI α Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Fc epsilon RI α Fc Chimera Protein, HumanProduct Specification Species Human Antigen Fc epsilon RI Accession P12319 1 Amino Acid Sequence Val 26 Leu204, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen Fc epsilon RI
Accession P12319-1
Amino Acid Sequence

Val 26-Leu204, with C-terminal Human IgG1 Fc

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 65-72kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc epsilon RI, the high-affinity IgE receptor, distinguishes Ag-IgE interactions and drives cellular allergic responses. Fc epsilon RI is primarily expressed on MCs, basophils and Ag-presenting cells, and mainly exists as the heterotetramer αβγ2. However, there are differences among species: an alternate trimeric form αγ2 is expressed on human, but not rodent. Structurally, it is composed of one α-chain bearing two extracellular immunoglobulin domains that bind to the Fc portion of a single molecule of IgE, a β-chain that holds an immunoreceptor tyrosine-based activation motif (ITAM), and a homodimer of disulfide-bound ITAM-containing γ-chains. Expression of the β chain in mast cells and basophils results in increased Fc epsilon RI surface expression and amplifies signaling through the receptor. The importance of the α-subunit in the Fc epsilon RI-mediated allergic reaction was demonstrated by the absence of allergic reactions in α-subunit-deficient mice. The Fc epsilon RIα binds to the Fc fragment of IgE at a 1:1 ratio to form the IgE-Fc complex. Fc epsilon RI is a unique molecular target that initiates different functional outcomes of MC responses and allergic inflammation. The recognition of multivalent antigen by Fc epsilon RI-bound IgE triggers a complex biochemical pathway initiated by the phosphorylation of ITAM motifs by the Src family kinase Lyn. Fc epsilon RI not occupied by IgE has a half-life on the mast cell surface of 24 hours in vitro, while receptors bound to IgE appear to be expressed for the life of the cell. The density of human basophil FcεR1 expression correlates directly with serum IgE levels, where binding of IgE stabilizes the receptor at the cell surface.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47176477191

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1972 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
A. Peri
Chelsea, US
★★★★★ 5
Best mineral sunscreen
Size: 3.4 Fl Oz (Pack of 1)
Mineral sunscreen that isn’t chalky or pasty.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
J
Verified Purchase
Joe
Belleville, US
★★★★★ 1
Product leaks into the cap
Size: 3.4 Fl Oz (Pack of 1), Size: 3.4 Fl Oz (Pack of 1)
The packaging appears to be defective and potentially tampered with. Specifically, the nozzle is a different color from the rest of the tube—one that is not consistent with the brand’s standard packaging (I am familiar with this brand and have purchased it before). Additionally, the cap does not close properly, causing the product to leak into the lid and resulting in unnecessary waste. This raises serious concerns about the product’s authenticity, quality control, and whether it may have been previously opened or altered.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
N
Verified Purchase
Narcoossee gal
Battle Creek, US
★★★★★ 5
Best facial sunscreen I have used
Coola makes the best facial sunscreen, and I have tried many brands previous to using Coola. The texture is light and creamy without being oily, absorbing well and leaving no white residue. It does not clog my pores and nor cause those white bumps that last for months. Coola sunscreen works well to protect my skin from sunburn and from making more freckles and dark spots. It has no perfumy fragrance, much to my relief. Once it has dried, I can apply concealer or powder over it. No oily streaks or caking of other make-up so I have no excuse to avoid wearing this sunscreen every day. I have recommended Coola facial sunscreen to my friends who had laser dermabrasion. Their skin is more sensitive to both perfumed chemicals and sun exposure, and they have given good reports too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2024
M
Verified Purchase
MK
New York, US
★★★★★ 5
Pricey, but worth it.
Coola products were included in a swag bag for a work vacation at a resort & I’ve not looked back. (The smell of the body spray sunscreen made me wish I could eat it, tbh.) This product has become my daily sunscreen as it’s the only one I’ve tried that doesn’t cause my skin to break out. I love the natural ingredients in their products AND that it doesn’t add to reef barrier breakdown. I only wish the brand wasn’t so pricey, but the benefits are worth it to me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025
A
Verified Purchase
Amazon Customer
Louisville, US
★★★★★ 5
Best sunscreen ever
Best sunscreen ever, never get burned when I use it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products