SKU: 98361191043

MDM2 Protein

Sale price$144.00 Regular price$160.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MDM2 ProteinProduct Specification Species Human Synonyms E3 ubiquitin protein ligase Mdm2,Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING type E3 ubiquitin transferase Mdm2,p53 binding protein Mdm2 Accession Q00987 Amino Acid Sequence S17 N111 SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN Expression System E. coli Purity 90% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Liquid Storage

Product Specification


Species Human
Synonyms E3 ubiquitin-protein ligase Mdm2,Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING-type E3 ubiquitin transferase Mdm2,p53-binding protein Mdm2
Accession Q00987
Amino Acid Sequence

S17-N111

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN

Expression System E.coli
Purity

>90% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris-HCl (pH 7.5), 200mM NaCl, 20% glycerol
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃
Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome. Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes them to proteasomal degradation (PubMed:12821780, PubMed:15053880, PubMed:15195100, PubMed:15632057, PubMed:16337594, PubMed:17290220, PubMed:19098711, PubMed:19219073, PubMed:19837670, PubMed:19965871, PubMed:20173098, PubMed:20385133, PubMed:20858735, PubMed:22128911). Ubiquitinates DCX, leading to DCX degradation and reduction of the dendritic spine density of olfactory bulb granule cells (By similarity). Ubiquitinates DLG4, leading to proteasomal degradation of DLG4 which is required for AMPA receptor endocytosis (By similarity). Negatively regulates NDUFS1, leading to decreased mitochondrial respiration, marked oxidative stress, and commitment to the mitochondrial pathway of apoptosis (PubMed:30879903). Binds NDUFS1 leading to its cytosolic retention rather than mitochondrial localization resulting in decreased supercomplex assembly (interactions between complex I and complex III), decreased complex I activity, ROS production, and apoptosis (PubMed:30879903).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98361191043

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1754 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Belleville, US
★★★★★ 5
Limited to 1 but it’s great soap
Great soap but cannot buy more than one, that’s such a bummer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
S
Verified Purchase
Sunshine
Dallas, US
★★★★★ 5
Order now!
This soap helps keeps that ass smooth and bright! Works amazingly on the armpits too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
N
Verified Purchase
Nordygirl
Chelsea, US
★★★★★ 5
Smells soooo good!
Oh my gosh guys! This soap smells soooo good! I have tried a few different bars and none of them were great. A lot of citrusy smelling soaps. I'm not a citrus fan. But this one? Amazing! I walk in to my bathroom a good 12 hours after my shower and the whole room smells so fresh and clean. Never has my bathroom smelled like a bar of soap unless someone just stepped out of the shower. I would buy this scent as a room sray, wax melt, candle, body mist, lotion - I'd buy it all! I typically gravitate to fresh clean scents like "clean linen" and this is great! As a bonus it is a super awesome exfoliater. Jury is still out on bumps - I only got it a few days ago, but I have high hopes. I will update my review if anything changes. (If you are on the fence just buy it!)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2024
B
Verified Purchase
buyer99
Massapequa, US
★★★★★ 5
EATS OIL TO SMOOTH YOUR FACE
Scent: Rose, Size: 2.5 Fl Oz (Pack of 1)
GET THIS!! here's what i've experienced with this item for the past week, and what i understand about about how well this item is working and will work based on what i've previously learned/experienced after heavy use of clay masks (successfully) in the past. THIS WILL RESTORE YOUR SKIN TO PERFECT TEXTURE (no 'large pores' at all). I'M SO EXCITED. i've been using used the kojic orange bar for a long while to try to even out damaged skin tone after overuse of clinique's face brush, which bar worked until it kinda didn't (even tho i can still leave it on til it burns a bit), so now am doing the lavender bar for morning/shower + this red tube before bed. i've used them both for a week and i am beyond excited about this red tube. this creamy product eats a ton of oil out of your pores. you'll still have the same texture of clogged pores afterward but only the color of skin instead of dark dots (since the dirt is only on top, as clean oil is always coming up from the bottom of your pores). eventually, deeply cleaning our your pores WILL eliminate 'large pores' and smooth out the texture of your skin (explained below). first, getting out so much oil that the dark dots are gone after a couple of nightly uses is definitive evidence that it's getting MORE OIL than other products. some other products MAY be getting out MORE than our daily accumulation, and so will also work EVENTUALLY -- but this is FASTER. specifically, my cheeks get clean but my nose still has dots - but i'm confident this'll catch up to digging out all the dirty oil in my nose as well. SO -- i'm sure that deep-cleaning all the dirt out of pores so there are no colored dots anymore is what they mean by 'brightening'... BUT... thoroughly cleaning out clogged pores (so deep that there's no dirt) will eventually smooth out skin texture cos the pores will eventually empty completely and then just shrink small/closed/smooth (like a baby again!). i previously experienced this progress after heavy use of queen helene's clay mask. my chinks literally shrank within 2 weeks. my pores looked the same, but the curve of my cheeks just flattened into my face. it was completely wild to see. when i applied mask mud, the oil in the pores of my nose and cheeks would actually soak dots into the otherwise dry & cracked mask so i had to pack the clay on so thick that it'd take so long to dry that i'd just take a nap for a over an hour, like every night for no more than 2 weeks. i was house/dog-sitting and had nothing better to do. and then my cheeks shrank. anyway, masks are boring and time consuming (and i did them so much that i still never feel any itchiness anymore) so i satisfied myself with progress without actually finishing my skin to perfectly smooth again -- given that actors in movies do close-ups that show terribly clogged pores anyway. THIS STUFF is way easier and quicker and less uncomfortable than a mask. you only need a small amount, maybe the size of two peas, and when you rub it on your cheeks it expands into a thickness that looks like clown makeup. no joke. the more you rub it, the thicker it gets - so i just keep going til i'm super white (and rubbing it up into my forehead) and then just rinse it off with my hands. my cheek pores look like SKIN. no colored dots at all, just texture. my nose still has dark dots but i'm sure that will also clean out eventually, too. HERE'S HOW IT WILL SMOOTH OUT YOUR SKIN -- after this cleaner, i use a toner (clinique) to tighten my pores to help narrow their newly emptied space against just filling back up again. without toner, i think the pores will still naturally close somewhat on their own. i think the closing of emptied pores (with or without toner) must also press the remaining oil closer to the surface into the empty space (given that it doesn't want it there in the first place) cos there's pressure where there's oil, and no pressure where there's no oil... i mean, using clay masks caused my cheeks to shrink altogether instead of, like, ending up with deep permanent empty needle tunnels into pores that stayed wide after the oil was eaten. my cheeks shrank cos the remaining oil moved up to the top (so my pores looked the same). forreal, your pores really don't want to be so swollen with oil that the skin in your face between the pores is literally pressed up into squishy pillows on the surface of your face. so this product with 'brighten' your face by removing the dark dots of dirt at the top of your pores, which is SO MUCH OIL that your face will press oil up to the top to be deep-cleaned again -- til eventually your pores close entirely and you have baby skin again. use an effective skin-tightening toner for even faster results. so my plan is to just keep deeply cleaning out the top oil with this stuff, tightening the empty skin with toner, and letting my skin keep pushing more oil up to be deep-cleaned by this great stuff the next night. i'm sure eventually it'll get to my nose, i might even start doing clay masks again. GET THIS STUFF!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2023
J
Verified Purchase
Joyce A Sutcliffe
Omaha, US
★★★★★ 5
Kojic
Scent: Orange, Size: 10.82 Fl Oz (Pack of 1)
Kojic acid has a slight, pleasant smell, suds well, and reduces dark spots.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 12, 2025

recommand products