SKU: 26860772679

MDM2 Protein

Sale price$144.00 Regular price$160.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 11 - Jul 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MDM2 ProteinProduct Specification Species Human Synonyms E3 ubiquitin protein ligase Mdm2,Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING type E3 ubiquitin transferase Mdm2,p53 binding protein Mdm2 Accession Q00987 Amino Acid Sequence S17 N111 SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN Expression System E. coli Purity 90% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Liquid Storage

Product Specification


Species Human
Synonyms E3 ubiquitin-protein ligase Mdm2,Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING-type E3 ubiquitin transferase Mdm2,p53-binding protein Mdm2
Accession Q00987
Amino Acid Sequence

S17-N111

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN

Expression System E.coli
Purity

>90% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris-HCl (pH 7.5), 200mM NaCl, 20% glycerol
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃
Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome. Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes them to proteasomal degradation (PubMed:12821780, PubMed:15053880, PubMed:15195100, PubMed:15632057, PubMed:16337594, PubMed:17290220, PubMed:19098711, PubMed:19219073, PubMed:19837670, PubMed:19965871, PubMed:20173098, PubMed:20385133, PubMed:20858735, PubMed:22128911). Ubiquitinates DCX, leading to DCX degradation and reduction of the dendritic spine density of olfactory bulb granule cells (By similarity). Ubiquitinates DLG4, leading to proteasomal degradation of DLG4 which is required for AMPA receptor endocytosis (By similarity). Negatively regulates NDUFS1, leading to decreased mitochondrial respiration, marked oxidative stress, and commitment to the mitochondrial pathway of apoptosis (PubMed:30879903). Binds NDUFS1 leading to its cytosolic retention rather than mitochondrial localization resulting in decreased supercomplex assembly (interactions between complex I and complex III), decreased complex I activity, ROS production, and apoptosis (PubMed:30879903).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26860772679

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1734 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stephanie K.
Lowell, US
★★★★★ 5
Perfect puppy starter kit and gift! Perfect for plane rides and kennel!
Color: Neutral, Color: Neutral
Perfect puppy gift! We use the kennel as her safe haven, and for potty training . This heartbeat tool is amazing and helped our puppy get acclimated to her kennel. She goes into her kennel and sleeps with it on her own. It calmed her down on the plane completely. We had a 6-hour flight and she did fine with the heartbeat toy. At home innthe kennel, the whining was very very minimal the first couple days, then it stopped. As you would hear and see her snuggle up and fall asleep. I think it is a bit pricy, but not too bad for the benefit. The heartbeat is seperate and is putninside a pouch on the stuffed animal. The blanket is soft, beautiful and perfect size. Good quality fabric. Both chew toys were loved by her.I do notice my large breed puppy prefers the rope and small tennis ball type chew toys. However, she plays with these too. Haven't used the heating packs yet, they go inside the pouch with the heartbeat item. I am sure we will because my puppy does love to be in front of my small heater under my desk to keep my feet warm. The packaging was extremely nice and fancy and was complimentary to the items inside.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2021
N
Verified Purchase
norra.theexplorer
Draper, US
★★★★★ 5
Best Idea for Puppy's First Day Home
Color: Pink
I was a bit reserved on purchasing this kit because it was a bit expensive. After a month now with my pup at home, this was the best investment for us and our GSD. On the first night, we used the heart beating snuggle puppy and blanket. She slept the entire night without an accident or a cry. The heartbeat in the snuggle puppy and the heat pad was the best idea. Our puppy never felt alone (just fyi, her crate was in the room with us for the 2 weeks). A month later, she is so protective of her snuggle puppy. We only used 1 heat pack to soothe her during the first week. The heat packs last a while. Our GSD now uses the snuggle puppy as a pillow or an object to be close to while she is in her crate. Any new puppy owner could definitely benefit from using this. Of course, with all things puppy, it does require a bit of time to correlate toys as a positive thing. We exclusively keep the snuggle puppy in her crate and make it a part of her secure place. My GSD puppy did really care for the teething heart toy. Even after freezing it, she didn't care for it. She also outgrew the small toy. She will chew it from time to time but it doesn't entertain her much. I found the kit, overall, very helpful with our puppy's adjustment to our home. She sleeps through the night since 8 weeks old and now at 12 weeks old. We've never had an accident in her crate overnight with the help with the snuggle puppy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2020
D
Verified Purchase
3 Dog Mom
Grantham, US
★★★★★ 5
Amazing kit for your puppy
Color: Blue
We’ve had 6 puppies over the years, and this is the first time we’ve had this wonderful little kit to welcome our little one home. We had the blanket with his litter so it smelled like them when he came home. He he loves that blanket, he loves the dog with the little heartbeat, and the teething toys. The 5 star review is because everything in this kit is so well made, really wonderful quality, and a great value. The blanket is a very nice thick plush, not some cheap one. The stuffed dog is big and fluffy and well made, the heartbeat works wonderfully, and the little chew toys safe and well made.i would encourage anyone who’s bringing home. A little one please get this first. It’s going to make your pup more comfortable when they get home, and will help then sleep better during the night and their naps. Very Well Done !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2021
S
Verified Purchase
S. Mangus
Lowell, US
★★★★★ 5
A must have for a new puppy.
Color: Pink
I just got my first new puppy in many years, and I was searching for ideas of what items I should get to be ready for her. A dog forum I belong to gave suggestions for items to prepare for a new pup. One of the items listed was a snuggle puppy. I was not familiar with the product, and did some research. I had always heard that lonesome puppies respond well to a hot water bottle and ticking clock for comfort. A friend had suggested a stuffed animal. I found all of that in one package - The Snuggle Puppy! And even better was the complete new puppy package. The blanket is adorable, very soft and the perfect size. The toys are perfect, and they include extra warmers for the puppy. I keep my girl in a kennel at night with her blanket and puppy. The first night I tried just the blanket, and she cried and howled for 15 minutes. Then I turned the heart beat on and put the puppy in the crate with her. Within 5 minutes she was quiet and stayed that way all night. I have used it every night since and not a peep. (It's been a week now). I would highly recommend these products to anyone bringing a pup home - it was a sleep saver for sure and she seems to love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2022
G
Verified Purchase
GSmith3rd
Phoenix, US
★★★★★ 5
Great for a small puppy
Color: Pink
Got these for my puppy, a German shepherd, while it was functional, she loved it, as it was chewability, durability and ease of use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025

recommand products