SKU: 8868763390

Biotinylated LILRA3 His&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated LILRA3 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms LILRA3, ILT6, LIR4, CD85e Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His&Avi tag

Product Specification


Species Human
Synonyms LILRA3, ILT6, LIR4, CD85e
Accession Q8N6C8
Amino Acid Sequence Gly24-Glu439, with C-terminal 8*His&Avi tag GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHHGLNDIFEAQKIEWHE
Expression System HEK293
Molecular Weight 68-75kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Knight J S. et al. (2017) Activated signature of antiphospholipid syndrome neutrophils reveals potential therapeutic target. JCI Insight. 2(18): e93897.

Background

Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8868763390

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1735 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jack Daniels
San Leandro, US
★★★★★ 5
Durable
My dog loves it. She takes it to  bed every night. It is sturdy, doesn’t seem like it will rip easily.  Why did you pick this product vs others?: Trying to replace a raccoon she got 4 year’s ago.  Squeak: Only squeaks when I squeeze it. 
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025
A
Verified Purchase
Alice A. Martin
Cuba, US
★★★★★ 5
As with all stuffed toys, supervision is needed.
I have a 6 month old standard size Golden Doodle who has gone through several raccoon toys. He loves their tails and to make them squeak. He knows the word raccoon, so when the last one “died”, I had to get another. This one is well made and has a magnificent tail. It did not take long, however, for Marvin to amputate two of the raccoon’s feet and pull the stuffing out. Luckily, I was able to get it from him before he swallowed any, and was able to sew up the injuries and return it to him for another round of play. I do not expect more from a stuffed toy, but I do not leave my dog alone with one and accept that supervision is always necessary. This raccoon is charming and when it “dies” I will probably buy it again. Five stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2020
S
Verified Purchase
susan Haralson
San Leandro, US
★★★★★ 5
Worth the money
El destructo not able to tear this one apart although he gave it his best effort.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
E
Verified Purchase
E. Browning
Birmingham, US
★★★★★ 5
My Cardigan Corgi loves this toy!
My 33-lb. Cardigan Corgi loved her raccoon toy so much that she finally tore off its tail and I had to get her another one. Good toy for a medium-sized doggo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
R
Verified Purchase
Rita Brown
San Leandro, US
★★★★★ 1
Not worth the price.
No two weeks old and the top seam opened up
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products