SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 742 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Calling Home
Houston, US
★★★★★ 4
The Stand Is the Unexpected Favorite
Color: Gray
I use this at my morning coffee station for mixing powdered supplements into my coffee shake — more than one goes in and it handles them without complaint. For a small battery-operated device it has real power. Cleans easily. The foam quality is good for home lattes without any particular technique required. But my favorite part is, unexpectedly, the stand. It’s sturdy and well made and gives me somewhere sensible to set a dripping frother instead of it lying on the counter. A small thing that earns its counter space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
L
Verified Purchase
Linda M
San Leandro, US
★★★★★ 5
Perfect frother
Color: Glossy Black
Absolutely love my frother. I'm actually impressed. This frother definitely makes a bigger better frothed milk. I use this frother multiple times a day and have been so pleased with the battery life. Easy and quick to charge. Love the reliability of this little gadget
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
C
Verified Purchase
C Dixon
Birmingham, US
★★★★★ 5
Pretty and works well
Color: Gray, Color: Gray
Love this and the stand it comes on. I’ve used it to mix everything from creatine, coffee creamer, and even pudding
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
M
Verified Purchase
Michelle S.
Birmingham, US
★★★★★ 5
This is the one!
Color: Gray
I ended up going with another brand, which I returned because it was impossible to insert the batteries into the too-tight compartment (other reviewers had the same issue and I should have listened). So I bought this one and not only is the battery compartment ample size and easy to insert the batteries into, the company even sends you two AA batteries to start you off! I also very much appreciate the fact that you don't have to hold down the button, just push it once to start and push it again to stop. It's powerful and I love that it sits in its own stand and looks nice in my kitchen while doing so.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
E
Verified Purchase
Elaine
Bozeman, US
★★★★★ 5
Great quality, great price and works great !
Color: Flat Black
Works great ! Quick delivery and great price and I love that it comes with a cover !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products