SKU: 11130877600

Ephrin B3 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin B3 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q15768 Amino Acid Sequence Leu28 Ser224, with C terminal Human IgG Fc

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11130877600

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 1964 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Calling Home
Bozeman, US
★★★★★ 4
The Stand Is the Unexpected Favorite
Color: Gray
I use this at my morning coffee station for mixing powdered supplements into my coffee shake — more than one goes in and it handles them without complaint. For a small battery-operated device it has real power. Cleans easily. The foam quality is good for home lattes without any particular technique required. But my favorite part is, unexpectedly, the stand. It’s sturdy and well made and gives me somewhere sensible to set a dripping frother instead of it lying on the counter. A small thing that earns its counter space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
L
Verified Purchase
Linda M
Lake Worth, US
★★★★★ 5
Perfect frother
Color: Glossy Black
Absolutely love my frother. I'm actually impressed. This frother definitely makes a bigger better frothed milk. I use this frother multiple times a day and have been so pleased with the battery life. Easy and quick to charge. Love the reliability of this little gadget
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
C
Verified Purchase
C Dixon
Alexandria, US
★★★★★ 5
Pretty and works well
Color: Gray, Color: Gray
Love this and the stand it comes on. I’ve used it to mix everything from creatine, coffee creamer, and even pudding
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
M
Verified Purchase
Michelle S.
Lowell, US
★★★★★ 5
This is the one!
Color: Gray
I ended up going with another brand, which I returned because it was impossible to insert the batteries into the too-tight compartment (other reviewers had the same issue and I should have listened). So I bought this one and not only is the battery compartment ample size and easy to insert the batteries into, the company even sends you two AA batteries to start you off! I also very much appreciate the fact that you don't have to hold down the button, just push it once to start and push it again to stop. It's powerful and I love that it sits in its own stand and looks nice in my kitchen while doing so.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
E
Verified Purchase
Elaine
Bozeman, US
★★★★★ 5
Great quality, great price and works great !
Color: Flat Black
Works great ! Quick delivery and great price and I love that it comes with a cover !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products